missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC20A1 Polyclonal antibody specifically detects SLC20A1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | SLC20A1 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 488 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | FLJ41426, Gibbon ape leukemia virus receptor 1, Glvr-1, GLVR1DKFZp686J2397, Leukemia virus receptor 1 homolog, Phosphate transporter 1, PiT-1PIT1, sodium-dependent phosphate transporter 1, solute carrier family 20 (phosphate transporter), member 1, Solute carrier family 20 member 1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 257-356 of human SLC20A1 (NP_005406.3).,, Sequence:, KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPN |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?