missing translation for 'onlineSavingsMsg'
Learn More

SLC20A1 Antibody [Alexa Fluor« 488], Novus Biologicals Biologicals™

Product Code. 30496865 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30496865 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30496865 Supplier Novus Biologicals Supplier No. NBP338075AF488

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SLC20A1 Polyclonal antibody specifically detects SLC20A1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC20A1
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 488
Formulation 50mM Sodium Borate
Gene Alias FLJ41426, Gibbon ape leukemia virus receptor 1, Glvr-1, GLVR1DKFZp686J2397, Leukemia virus receptor 1 homolog, Phosphate transporter 1, PiT-1PIT1, sodium-dependent phosphate transporter 1, solute carrier family 20 (phosphate transporter), member 1, Solute carrier family 20 member 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 257-356 of human SLC20A1 (NP_005406.3).,, Sequence:, KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPN
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6574
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.