missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MEIS1 Polyclonal antibody specifically detects MEIS1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | MEIS1 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 525 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | homeobox protein Meis1, leukemogenic homolog protein, Meis homeobox 1, MGC43380, myeloid ecotropic viral integration site 1 homolog, myeloid ecotropic viral integration site 1 homolog (mouse) |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-390 of human MEIS1 (NP_002389.1).,, Sequence:, PSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?