missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Atlastin-2 Polyclonal antibody specifically detects Atlastin-2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Atlastin-2 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | DyLight 680 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | ADP-ribosylation factor-like 6 interacting protein 2, ADP-ribosylation factor-like protein 6-interacting protein 2, ADP-ribosylation-like factor 6 interacting protein 2, aip-2, ARL3IP2, ARL-6-interacting protein 2, ARL6IP2, atlastin GTPase 2, atlastin2, atlastin-2, EC 3.6.5.-, FLJ23293 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 390-470 of human Atlastin-2 (NP_001129145.1).,, Sequence:, ARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFY |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?