missing translation for 'onlineSavingsMsg'
Learn More

HOP Antibody [mFluor Violet 450 SE], Novus Biologicals Biologicals™

Product Code. 30503843 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30503843 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30503843 Supplier Novus Biologicals Supplier No. NBP335571MFV450

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

HOP Polyclonal antibody specifically detects HOP in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen HOP
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate mFluor Violet 450 SE
Formulation 50mM Sodium Borate
Gene Alias CAMEO, HOD, homeodomain-only protein, HOP homeobox, HOPLAGYNECC1OB1SMAP31, Lung cancer-associated Y protein, MGC20820, not expressed in choriocarcinoma clone 1, Not expressed in choriocarcinoma protein 1, odd homeobox 1 protein, Odd homeobox protein 1, TOTO
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human HOP (NP_631957.1).,, Sequence:, MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 84525
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.