missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
UBE2R1/CDC34 Polyclonal antibody specifically detects UBE2R1/CDC34 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | UBE2R1/CDC34 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | FITC |
| Formulation | PBS |
| Gene Alias | cell division cycle 34, cell division cycle 34 homolog (S. cerevisiae), E2-CDC34, EC 6.3.2.19, UBC3, UBE2R1UBCH3, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 R1, Ubiquitin-conjugating enzyme E2-32 kDa complementing, Ubiquitin-conjugating enzyme E2-CDC34, Ubiquitin-protein ligase R1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 150-236 of human UBE2R1/CDC34 (NP_004350.1).,, Sequence:, KWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?