missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
GSTO2 Polyclonal antibody specifically detects GSTO2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | GSTO2 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | DyLight 405 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | bA127L20.1, bA127L20.1 (novel glutathione-S-transferase), EC 2.5.1.18, glutathione S-transferase omega 2, glutathione S-transferase omega-2, glutathione-S-transferase-like protein, GSTO-2 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 124-243 of human GSTO2 (NP_899062.1).,, Sequence:, PHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?