missing translation for 'onlineSavingsMsg'
Learn More

KChIP2 Antibody [DyLight 755], Novus Biologicals Biologicals™

Product Code. 30511404 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30511404 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30511404 Supplier Novus Biologicals Supplier No. NBP338383IR

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

KChIP2 Polyclonal antibody specifically detects KChIP2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen KChIP2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 755
Formulation 50mM Sodium Borate
Gene Alias A-type potassium channel modulatory protein 2, cardiac voltage gated potassium channel modulatory subunit, Cardiac voltage-gated potassium channel modulatory subunit, DKFZp566L1246, KChIP2, KCHIP2Kv channel-interacting protein 2, Kv channel interacting protein 2, MGC17241, potassium channel interacting protein 2, Potassium channel-interacting protein 2
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KChIP2 (NP_775284.1).,, Sequence:, MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQ
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Vision
Primary or Secondary Primary
Gene ID (Entrez) 30819
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.