missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30511876

p53 AIP1 Antibody [Biotin], Novus Biologicals Biologicals™

Product Code. 30511876 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity
30511876 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30511876 Supplier Novus Biologicals Supplier No. NBP338400B

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

p53 AIP1 Polyclonal antibody specifically detects p53 AIP1 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen p53 AIP1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Biotin
Formulation PBS
Gene Alias p53AIP1, p53-regulated apoptosis-inducing protein 1, tumor protein p53 regulated apoptosis inducing protein 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human p53 AIP1 (NP_001238893.1).,, Sequence:, MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Apoptosis, DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 63970
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.