missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30512741

VAMP3/Cellubrevin Antibody [Alexa Fluor« 594], Novus Biologicals Biologicals™

Product Code. 30512741 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity
30512741 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30512741 Supplier Novus Biologicals Supplier No. NBP338430AF594

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

VAMP3/Cellubrevin Polyclonal antibody specifically detects VAMP3/Cellubrevin in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen VAMP3/Cellubrevin
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 594
Formulation 50mM Sodium Borate
Gene Alias CEBCellubrevin, cellubrevin, SYB3, Synaptobrevin-3, VAMP-3, vesicle-associated membrane protein 3, vesicle-associated membrane protein 3 (cellubrevin)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human VAMP3/Cellubrevin (NP_004772.1).,, Sequence:, MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWA
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Membrane Trafficking and Chaperones, Neuronal Cell Markers, Neurotransmission
Primary or Secondary Primary
Gene ID (Entrez) 9341
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.