missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30514305

Troponin I type 2 (fast skeletal) Antibody [Allophycocyanin], Novus Biologicals Biologicals™

Product Code. 30514305 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30514305 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30514305 Supplier Novus Biologicals Supplier No. NBP338486APC

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Troponin I type 2 (fast skeletal) Polyclonal antibody specifically detects Troponin I type 2 (fast skeletal) in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Troponin I type 2 (fast skeletal)
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate APC
Formulation PBS
Gene Alias skeletal, fast, troponin I type 2 (skeletal, fast), troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, troponin I, fast-twitch skeletal muscle isoform
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Troponin I type 2 (fast skeletal) (Troponin I type 2 (fast skeletal) (TNNI2)) (NP_003273.1).,, Sequence:, MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Biology, Cytoskeleton Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7136
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.