missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MRP2 Polyclonal antibody specifically detects MRP2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | MRP2 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | CoraFluor 1 |
| Formulation | PBS |
| Gene Alias | ATP-binding cassette, sub-family C (CFTR/MRP), member 2, Canalicular multidrug resistance protein, canalicular multispecific organic anion transporter 1, CMOAT1, CMOATABC30, CMRP, DJS, KIAA1010, MRP2ATP-binding cassette sub-family C member 2, Multidrug resistance-associated protein 2 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-315 of human MRP2 (NP_000383.1).,, Sequence:, ETDNLIQTTIQNEFAHCTVITIAHRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?