missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30517742

TAB2 Antibody [PerCP], Novus Biologicals Biologicals™

Product Code. 30517742 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30517742 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30517742 Supplier Novus Biologicals Supplier No. NBP338625PCP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TAB2 Polyclonal antibody specifically detects TAB2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen TAB2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate PerCP
Formulation PBS
Gene Alias FLJ21885, KIAA0733CHTD2, MAP3K7IP2mitogen-activated protein kinase kinase kinase 7 interacting protein 2, Mitogen-activated protein kinase kinase kinase 7-interacting protein 2, TAB-2, TAK1-binding protein 2, TGF-beta activated kinase 1/MAP3K7 binding protein 2, TGF-beta-activated kinase 1 and MAP3K7-binding protein 2, TGF-beta-activated kinase 1-binding protein 2
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 510-620 of human TAB2 (NP_055908.1).,, Sequence:, TLAHVDRISETRKLSMGSDDAAYTQALLVHQKARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNRQLQIDIDCLTKEIDLFQARG
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cytokine Research, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 23118
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.