missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
5-HT1D Polyclonal antibody specifically detects 5-HT1D in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | 5-HT1D |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | 5-HT-1D, 5-HT-1D-alpha, 5-HT1DHTR1DA, 5-hydroxytryptamine (serotonin) receptor 1D, HT1DA, HTRL, RDC4,5-hydroxytryptamine receptor 1D, Serotonin receptor 1D |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HTR1D (NP_000855.1). RTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAG |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?