missing translation for 'onlineSavingsMsg'
Learn More
Learn More
5-HT3E Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33578
This item is not returnable.
View return policy
Description
5-HT3E Polyclonal specifically detects 5-HT3E in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| 5-HT3E | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| A5X5Y0 | |
| HTR3E | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LAFILSRATPRPALGPLSYREHRVALLHLTHSMSTTGRGVTFTINCSGF | |
| 0.1 mL | |
| Signal Transduction | |
| 285242 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5-HT3 receptor subunit E splice variant HTR3Ea, 5-HT3c1,5-HT3E, 5-hydroxytryptamine (serotonin) receptor 3, family member E, 5-hydroxytryptamine receptor 3E, MGC120035, MGC120036, serotonin receptor 3E | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction