missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AK3L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Specifications
| Antigen | AK3L1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18115168
|
Novus Biologicals
NBP2-47553 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18655935
|
Novus Biologicals
NBP2-47553-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AK3L1 Polyclonal specifically detects AK3L1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| AK3L1 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 205 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PEAVAARLRQYKDVAKPVIELYKSRGVLHQF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| adenylate kinase 3, Adenylate kinase 3-like, adenylate kinase 3-like 1, adenylate kinase 4, AK3adenylate kinase isoenzyme 4, mitochondrial, AK3L1, AK3L2, ATP-AMP transphosphorylase, EC 2.7.4, EC 2.7.4.3, GTP:AMP phosphotransferase, MGC166959, mitochondrial adenylate kinase-3, nucleoside-triphosphate-adenylate kinase | |
| AK4 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title