missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. AKAP1 Antibody, Novus Biologicals™

AKAP1 Antibody, Novus Biologicals™

Product Code. 18214798 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18214798 0.1 mL 0.1mL
18422271 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18214798 Proveedor Novus Biologicals N.º de proveedor NBP189172

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody has been used in 1 publication

AKAP1 Polyclonal specifically detects AKAP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen AKAP1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q92667
Gene Alias A kinase (PRKA) anchor protein 1, a kinase anchor protein 1, mitochondrial, AKAP121, AKAP149AKAP 149, AKAP84, A-kinase anchor protein 1, mitochondrial, A-kinase anchor protein 149 kDa, A-kinase anchor protein, 149kD, D-AKAP1, D-AKAP-1, Dual specificity A-kinase-anchoring protein 1, dual-specificity A-kinase anchoring protein 1, MGC1807, PRKA1, protein kinase A anchoring protein 1, protein kinase A1, Protein kinase A-anchoring protein 1, protein kinase anchoring protein 1, S-AKAP84, SAKAP84AKAP, Spermatid A-kinase anchor protein 84
Gene Symbols AKAP1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8165
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.