missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ALDH7A1 Polyclonal antibody specifically detects ALDH7A1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | ALDH7A1 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | DyLight 650 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | aldehyde dehydrogenase 7 family, member A1, Aldehyde dehydrogenase family 7 member A1,26g turgor protein homolog, Alpha-AASA dehydrogenase, ATQ1Antiquitin-1, Betaine aldehyde dehydrogenase, Delta1-piperideine-6-carboxylate dehydrogenase, EC 1.2.1, EC 1.2.1.3, EC 1.2.1.31, EC 1.2.1.8, EPDalpha-aminoadipic semialdehyde dehydrogenase, FLJ11738, FLJ92814, P6c dehydrogenase, PDEantiquitin-1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2).,, Sequence:, APILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?