missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APXL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68774
This item is not returnable.
View return policy
Description
APXL Polyclonal antibody specifically detects APXL in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| APXL | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| apical protein, Xenopus laevis-like, apical protein-like (Xenopus laevis), Apical-like protein, APX homolog of Xenopus, APXLHSAPXL, DKFZp781J074, FLJ39277, Protein APXL, protein Shroom2, shroom family member 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ | |
| 100 μg | |
| Vision | |
| 357 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction