missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APXL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | APXL |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|
18637786
|
Novus Biologicals
NBP2-68774-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18667786
|
Novus Biologicals
NBP2-68774 |
100 μg |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descrizione
APXL Polyclonal antibody specifically detects APXL in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifica
| APXL | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Vision | |
| PBS (pH 7.2) and 40% Glycerol | |
| 357 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| apical protein, Xenopus laevis-like, apical protein-like (Xenopus laevis), Apical-like protein, APX homolog of Xenopus, APXLHSAPXL, DKFZp781J074, FLJ39277, Protein APXL, protein Shroom2, shroom family member 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto