missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP11B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88901
This item is not returnable.
View return policy
Description
ATP11B Polyclonal antibody specifically detects ATP11B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ATP11B | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ATPase class VI type 11B, ATPase IR, ATPase, class VI, type 11B, ATPIFKIAA0956probable phospholipid-transporting ATPase IF, ATPIRMGC46576, DKFZp434J238, DKFZp434N1615, EC 3.6.3, EC 3.6.3.1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ETAVSVSLSCGHFHRTMNILELINQKSDSECAEQLRQLARRITEDHVIQHGLVVDGTSLSLALREHEKLFMEVCRN | |
| 0.1 mL | |
| Cancer, Cell Cycle and Replication | |
| 23200 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction