missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP11B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 572.00 €
Specifications
| Antigen | ATP11B |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18483551
|
Novus Biologicals
NBP1-88901-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18413951
|
Novus Biologicals
NBP1-88901 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ATP11B Polyclonal antibody specifically detects ATP11B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ATP11B | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol | |
| 23200 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ATPase class VI type 11B, ATPase IR, ATPase, class VI, type 11B, ATPIFKIAA0956probable phospholipid-transporting ATPase IF, ATPIRMGC46576, DKFZp434J238, DKFZp434N1615, EC 3.6.3, EC 3.6.3.1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ETAVSVSLSCGHFHRTMNILELINQKSDSECAEQLRQLARRITEDHVIQHGLVVDGTSLSLALREHEKLFMEVCRN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title