missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Atrial Natriuretic Peptide/ANP Antibody [Janelia Fluor« 646], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
Atrial Natriuretic Peptide/ANP Polyclonal antibody specifically detects Atrial Natriuretic Peptide/ANP in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Atrial Natriuretic Peptide/ANP |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 646 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | ANF, ANPatriopeptin, ATFB6, atrial natriuretic factor, Atrial natriuretic peptide, CDD-ANF, natriuretic peptide A, natriuretic peptide precursor A, PNDcardionatrin, prepronatriodilatin |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human Atrial Natriuretic Peptide/ANP (NP_006154.1).,, Sequence:, LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?