missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Bad Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38947-25ul
This item is not returnable.
View return policy
Description
Bad Polyclonal specifically detects Bad in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Bad | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q92934 | |
| BAD | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR | |
| 25 μL | |
| Angiogenesis, Apoptosis, Cancer, Death Receptor Signaling Pathway, GPCR, Neuroscience, Tumor Suppressors | |
| 572 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BBC2, BBC6, bcl2 antagonist of cell death, BCL2-antagonist of cell death protein, BCL2-associated agonist of cell death, Bcl-2-binding component 6, BCL2-binding component 6, BCL2-binding protein, Bcl2-L-8, BCL2L8bcl2-L-8, Bcl-2-like protein 8, BCL-X/BCL-2 binding protein, Bcl-XL/Bcl-2-associated death promoter | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction