missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BRCA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62628-25ul
This item is not returnable.
View return policy
Description
BRCA1 Polyclonal antibody specifically detects BRCA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| BRCA1 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| BRCAI, breast and ovarian cancer susceptibility protein 1, breast and ovarian cancer sususceptibility protein, breast cancer 1, early onset, breast cancer type 1 susceptibility protein, EC 6.3.2, EC 6.3.2.-, IRIS, PNCA4, PSCP, subunit 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDA | |
| 25 μL | |
| Apoptosis, Breast Cancer, Cancer, Cell Biology, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Homologous Recombination, Tumor Suppressors, Ubiquitin Proteasome Pathway, Zinc Finger | |
| 672 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction