missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BRCA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 470.00 €
Specifications
| Antigen | BRCA1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18600349
|
Novus Biologicals
NBP2-62628-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615328
|
Novus Biologicals
NBP2-62628 |
100 μg |
470.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BRCA1 Polyclonal antibody specifically detects BRCA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| BRCA1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Breast Cancer, Cancer, Cell Biology, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Homologous Recombination, Tumor Suppressors, Ubiquitin Proteasome Pathway, Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol | |
| 672 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BRCAI, breast and ovarian cancer susceptibility protein 1, breast and ovarian cancer sususceptibility protein, breast cancer 1, early onset, breast cancer type 1 susceptibility protein, EC 6.3.2, EC 6.3.2.-, IRIS, PNCA4, PSCP, subunit 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts