missing translation for 'onlineSavingsMsg'
Learn More
Learn More
c-Myb Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21349-100ul
This item is not returnable.
View return policy
Description
c-Myb Polyclonal antibody specifically detects c-Myb in Human samples. It is validated for Immunofluorescence
Specifications
| c-Myb | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| c-myb, Cmyb, c-myb protein (140 AA), c-myb_CDS, c-myb10A_CDS, c-myb13A_CDS, c-myb14A_CDS, c-myb8B_CDS, efg, Proto-oncogene c-Myb, transcriptional activator Myb, v-myb avian myeloblastosis viral oncogene homolog, v-myb myeloblastosis viral oncogene homolog (avian) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: HSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSD | |
| 100 μg | |
| Cancer, Phospho Specific | |
| 4602 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction