missing translation for 'onlineSavingsMsg'
Learn More
Learn More
c-Myb Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
401.00 € - 672.00 €
Specifications
| Antigen | c-Myb |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18690775
|
Novus Biologicals
NBP3-21349-100ul |
100 μg |
672.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18675184
|
Novus Biologicals
NBP3-21349-25ul |
25 μg |
401.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
c-Myb Polyclonal antibody specifically detects c-Myb in Human samples. It is validated for ImmunofluorescenceSpecifications
| c-Myb | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Phospho Specific | |
| PBS, pH 7.2, 40% glycerol | |
| 4602 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| c-myb, Cmyb, c-myb protein (140 AA), c-myb_CDS, c-myb10A_CDS, c-myb13A_CDS, c-myb14A_CDS, c-myb8B_CDS, efg, Proto-oncogene c-Myb, transcriptional activator Myb, v-myb avian myeloblastosis viral oncogene homolog, v-myb myeloblastosis viral oncogene homolog (avian) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: HSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title