missing translation for 'onlineSavingsMsg'
Learn More

C4 binding protein A Antibody [mFluor Violet 450 SE], Novus Biologicals Biologicals™

Product Code. 30513299 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30513299 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30513299 Supplier Novus Biologicals Supplier No. NBP338450MFV450

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

C4 binding protein A Polyclonal antibody specifically detects C4 binding protein A in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen C4 binding protein A
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate mFluor Violet 450 SE
Formulation 50mM Sodium Borate
Gene Alias C4b binding protein, alpha chain, C4b-binding protein alpha chain, C4BP, complement component 4 binding protein, alpha, complement component 4 binding protein, alpha chain, complement component 4-binding protein, alpha, Proline-rich protein, PRP
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human C4 binding protein A (NP_000706.1).,, Sequence:, QYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 722
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.