missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calbindin D-28K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38798-25ul
This item is not returnable.
View return policy
Description
Calbindin D-28K Polyclonal specifically detects Calbindin D-28K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Calbindin D-28K | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| P05937 | |
| CALB1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELT | |
| 25 μL | |
| Neuronal Cell Markers, Neuroscience, Neurotransmission, Stem Cell Markers | |
| 793 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CAB27, CALB, calbindin, calbindin 1, (28kD), calbindin 1, 28kDa, Calbindin D28, D-28K, RTVL-H protein, Vitamin D-dependent calcium-binding protein, avian-type | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction