missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calbindin D-28K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Specifications
| Antigen | Calbindin D-28K |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18640516
|
Novus Biologicals
NBP2-38798-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18199927
|
Novus Biologicals
NBP2-38798 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Calbindin D-28K Polyclonal specifically detects Calbindin D-28K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Calbindin D-28K | |
| Polyclonal | |
| Rabbit | |
| Neuronal Cell Markers, Neuroscience, Neurotransmission, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CAB27, CALB, calbindin, calbindin 1, (28kD), calbindin 1, 28kDa, Calbindin D28, D-28K, RTVL-H protein, Vitamin D-dependent calcium-binding protein, avian-type | |
| CALB1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P05937 | |
| 793 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title