missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Calpastatin Antibody - BSA Free, Novus Biologicals™

Calpastatin Antibody - BSA Free, Novus Biologicals™

Product Code. 18617271 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18617271 0.1 mL 0.1mL
18625510 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18617271 Supplier Novus Biologicals Supplier No. NBP2929410.1ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Calpastatin Polyclonal antibody specifically detects Calpastatin in Human, Mouse, Rat samples. It is validated for Western Blot, Gene Knock-Out
TRUSTED_SUSTAINABILITY

Specifications

Antigen Calpastatin
Applications Western Blot, Gene Knock-Out
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Knockout Validated
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias BS-17, Calpain inhibitor, calpastatin, MGC9402, Sperm BS-17 component
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 510-610 of human Calpastatin (NP_001177371.1). QNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLD
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Hypoxia, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 831
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.