missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calpastatin Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92941-0.1ml
This item is not returnable.
View return policy
Description
Calpastatin Polyclonal antibody specifically detects Calpastatin in Human, Mouse, Rat samples. It is validated for Western Blot, Gene Knock-Out
Specifications
| Calpastatin | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Knockout Validated | |
| BS-17, Calpain inhibitor, calpastatin, MGC9402, Sperm BS-17 component | |
| A synthetic peptide corresponding to a sequence within amino acids 510-610 of human Calpastatin (NP_001177371.1). QNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLD | |
| 0.1 mL | |
| Hypoxia, Neuroscience | |
| 831 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Gene Knock-Out | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction