missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calpastatin Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
226.00 € - 474.00 €
Specifications
| Antigen | Calpastatin |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, Knockout Validated |
| Applications | Western Blot, Gene Knock-Out |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18625510
|
Novus Biologicals
NBP2-92941-0.02ml |
0.02 mL |
226.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18617271
|
Novus Biologicals
NBP2-92941-0.1ml |
0.1 mL |
474.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Calpastatin Polyclonal antibody specifically detects Calpastatin in Human, Mouse, Rat samples. It is validated for Western Blot, Gene Knock-OutSpecifications
| Calpastatin | |
| Western Blot, Gene Knock-Out | |
| Unconjugated | |
| Rabbit | |
| Hypoxia, Neuroscience | |
| PBS with 50% glycerol, pH7.3. | |
| 831 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, Knockout Validated | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| BS-17, Calpain inhibitor, calpastatin, MGC9402, Sperm BS-17 component | |
| A synthetic peptide corresponding to a sequence within amino acids 510-610 of human Calpastatin (NP_001177371.1). QNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title