missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CaM Kinase II gamma Antibody [Janelia Fluor« 669], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
CaM Kinase II gamma Polyclonal antibody specifically detects CaM Kinase II gamma in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | CaM Kinase II gamma |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 669 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma, calcium/calmodulin-dependent protein kinase II gamma, calcium/calmodulin-dependent protein kinase type II subunit gamma, CaM kinase II subunit gamma, CAMK, CAMKGFLJ16043, CAMK-II, CaMK-II subunit gamma, EC 2.7.11, EC 2.7.11.17, MGC26678 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-410 of human CaM Kinase II gamma (NP_751909.1).,, Sequence:, LKGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAI |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?