missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Caspase-6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 671.00 €
Specifications
| Antigen | Caspase-6 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18401892
|
Novus Biologicals
NBP1-87684 |
0.1 mL |
671.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18489821
|
Novus Biologicals
NBP1-87684-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Caspase-6 Polyclonal antibody specifically detects Caspase-6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Caspase-6 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Caspases | |
| PBS (pH 7.2) and 40% Glycerol | |
| 839 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Apoptotic protease Mch-2, CASP-6, caspase 6, apoptosis-related cysteine peptidase, caspase 6, apoptosis-related cysteine protease, caspase-6, EC 3.4.22, MCH2EC 3.4.22.59 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title