missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21328-100ul
This item is not returnable.
View return policy
Description
CCR3 Polyclonal antibody specifically detects CCR3 in Human samples. It is validated for Immunofluorescence
Specifications
| CCR3 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| b-chemokine receptor, CC chemokine receptor 3, C-C chemokine receptor type 3, C-C CKR-3, CCR-3, CD193 antigen, chemokine (C-C motif) receptor 3, CKR3CC-CKR-3CMKBR3CD193, eosinophil CC chemokine receptor 3, Eosinophil eotaxin receptor, MGC102841 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI | |
| 100 μg | |
| Chemokines and Cytokines, Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction | |
| 1232 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction