missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
378.00 € - 648.00 €
Specifications
| Antigen | CCR3 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18611374
|
Novus Biologicals
NBP3-21328-100ul |
100 μg |
648.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18611404
|
Novus Biologicals
NBP3-21328-25ul |
25 μg |
378.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CCR3 Polyclonal antibody specifically detects CCR3 in Human samples. It is validated for ImmunofluorescenceSpecifications
| CCR3 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Chemokines and Cytokines, Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 1232 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| b-chemokine receptor, CC chemokine receptor 3, C-C chemokine receptor type 3, C-C CKR-3, CCR-3, CD193 antigen, chemokine (C-C motif) receptor 3, CKR3CC-CKR-3CMKBR3CD193, eosinophil CC chemokine receptor 3, Eosinophil eotaxin receptor, MGC102841 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title