missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD84/SLAMF5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 605.00 €
Specifications
| Antigen | CD84/SLAMF5 |
|---|---|
| Dilution | Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18624158
|
Novus Biologicals
NBP2-49635-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18629908
|
Novus Biologicals
NBP2-49635 |
0.1 mL |
605.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD84/SLAMF5 Polyclonal antibody specifically detects CD84/SLAMF5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CD84/SLAMF5 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| CD Markers, Immunology, Stem Cells | |
| PBS (pH 7.2), 40% Glycerol | |
| 8832 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD84 antigen, CD84 antigen (leukocyte antigen), CD84 molecule, Cell surface antigen MAX.3, DKFZp781E2378, hCD84, hly9-beta, leucocyte differentiation antigen CD84, leukocyte antigen CD84, Leukocyte differentiation antigen CD84, mCD84, Signaling lymphocytic activation molecule 5, SLAM family member 5, SLAMF5LY9B | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RRQGRIFPEDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title