missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Cdk5 Polyclonal antibody specifically detects Cdk5 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Cdk5 |
| Applications | ELISA, Immunoprecipitation, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 700 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | Cell division protein kinase 5, cyclin-dependent kinase 5, EC 2.7.11, EC 2.7.11.22, protein kinase CDK5 splicing, PSSALRE, Serine/threonine-protein kinase PSSALRE, Tau protein kinase II catalytic subunit, TPKII catalytic subunit |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human Cdk5 (NP_004926.1).,, Sequence:, PDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?