missing translation for 'onlineSavingsMsg'
Learn More

CEBP Beta Antibody [Janelia Fluor« 646], Novus Biologicals Biologicals™

Product Code. 30492429 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30492429 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30492429 Supplier Novus Biologicals Supplier No. NBP335083JF646

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

CEBP Beta Polyclonal antibody specifically detects CEBP Beta in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen CEBP Beta
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Janelia Fluor 646
Formulation 50mM Sodium Borate
Gene Alias C/EBP beta, C/EBP-beta, CCAAT/enhancer binding protein (C/EBP), beta, CCAAT/enhancer-binding protein beta, CRP2, IL6DBP, interleukin 6-dependent DNA-binding protein, LAPTCF-5, Liver activator protein, liver-enriched transcriptional activator protein, MGC32080, NF-IL6, Nuclear factor NF-IL6, nuclear factor of interleukin 6, TCF5NFIL6, Transcription factor 5
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 171-216 of human CEBP Beta (NP_005185.2).,, Sequence:, AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Phospho Specific
Primary or Secondary Primary
Gene ID (Entrez) 1051
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.