missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CHERP Polyclonal antibody specifically detects CHERP in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | CHERP |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 350 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | calcium homeostasis endoplasmic reticulum protein, DAN16, DAN26, ERPROT 213-21, ERPROT213-21, protein with polyglutamine repeat, SCAF6, SRA1, SR-related CTD associated factor 6, SR-related CTD-associated factor 6 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 650-750 of human CHERP (NP_006378.3).,, Sequence:, LPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSS |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?