missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Claudin-5 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92846-0.1ml
This item is not returnable.
View return policy
Description
Claudin-5 Polyclonal antibody specifically detects Claudin-5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| Claudin-5 | |
| Polyclonal | |
| Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| AWALTransmembrane protein deleted in VCFS, BEC1, claudin 5, claudin-5, CPETRL1, TMVCFTMDVCF, transmembrane protein deleted in velocardiofacial syndrome | |
| A synthetic peptide corresponding to a sequence within amino acids 119-218 of human Claudin-5 (NP_001349995.1). LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV | |
| 0.1 mL | |
| Cellular Markers | |
| 7122 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction