missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Claudin-5 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
225.00 € - 498.00 €
Specifications
| Antigen | Claudin-5 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18615812
|
Novus Biologicals
NBP2-92846-0.02ml |
0.02 mL |
225.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18682982
|
Novus Biologicals
NBP2-92846-0.1ml |
0.1 mL |
498.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Claudin-5 Polyclonal antibody specifically detects Claudin-5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Claudin-5 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cellular Markers | |
| PBS with 50% glycerol, pH7.3. | |
| 7122 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| AWALTransmembrane protein deleted in VCFS, BEC1, claudin 5, claudin-5, CPETRL1, TMVCFTMDVCF, transmembrane protein deleted in velocardiofacial syndrome | |
| A synthetic peptide corresponding to a sequence within amino acids 119-218 of human Claudin-5 (NP_001349995.1). LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title