missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen IX alpha 2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92360-0.02ml
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Collagen IX alpha 2 Polyclonal antibody specifically detects Collagen IX alpha 2 in Rat samples. It is validated for Western Blot
Spezifikation
| Collagen IX alpha 2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Alpha 2 Type IX Collagen, COL9A2, Collagen Alpha-2(IX) Chain, Collagen IX, Alpha-2 Polypeptide, Collagen, Type IX, Alpha 2, DJ39G22.4, EDM2, MED, STL5 | |
| A synthetic peptide corresponding to a sequence within amino acids 600-689 of human Collagen IX alpha 2 (NP_001843.1). RGEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGLPGFCEPAACLGASAYASARLTEPGSIKGP | |
| 0.02 mL | |
| Primary | |
| Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 1298 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur