missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen IX alpha 2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 463.00 €
Specifications
| Antigen | Collagen IX alpha 2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18687461
|
Novus Biologicals
NBP2-92360-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18646100
|
Novus Biologicals
NBP2-92360-0.1ml |
0.1 mL |
463.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Collagen IX alpha 2 Polyclonal antibody specifically detects Collagen IX alpha 2 in Rat samples. It is validated for Western BlotSpecifications
| Collagen IX alpha 2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| Alpha 2 Type IX Collagen, COL9A2, Collagen Alpha-2(IX) Chain, Collagen IX, Alpha-2 Polypeptide, Collagen, Type IX, Alpha 2, DJ39G22.4, EDM2, MED, STL5 | |
| A synthetic peptide corresponding to a sequence within amino acids 600-689 of human Collagen IX alpha 2 (NP_001843.1). RGEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGLPGFCEPAACLGASAYASARLTEPGSIKGP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS with 50% glycerol, pH7.3. | |
| 1298 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title