missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen VI alpha 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55655-25ul
This item is not returnable.
View return policy
Description
Collagen VI alpha 2 Polyclonal specifically detects Collagen VI alpha 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Collagen VI alpha 2 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| collagen alpha-2(VI) chain, collagen VI, alpha-2 polypeptide, collagen, type VI, alpha 2,10PP3610, DKFZp586E1322, FLJ46862 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 1292 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| COL6A2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGTVHFAVVITDGHVTGSPCGGIKLQAERAREEGIRLFAVAPNQNLKEQGLRDIASTPHELYRNDYATMLPDSTEIDQDTINRIIKVMKHEAYGECYKVSC | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering