missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Complement C7 Antibody [Alexa Fluor« 700], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
Complement C7 Polyclonal antibody specifically detects Complement C7 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Complement C7 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 700 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | complement component 7, complement component C7 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 22-270 of human Complement C7 (NP_000578.2).,, Sequence:, RSVAVYGQYGGQPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCEDSERRPSCDIDKPPPNIELTGNGYNELTGQ |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?