missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Connexin 43/GJA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 498.00 €
Specifications
| Antigen | Connexin 43/GJA1 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18627396
|
Novus Biologicals
NBP2-68678-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18691529
|
Novus Biologicals
NBP2-68678 |
100 μg |
498.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Connexin 43/GJA1 Polyclonal antibody specifically detects Connexin 43/GJA1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| Connexin 43/GJA1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cellular Markers, Core ESC Like Genes, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2697 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| connexin 43, connexin-43, Cx43, CX43gap junction protein, alpha-like, DFNB38, Gap junction 43 kDa heart protein, gap junction alpha-1 protein, gap junction protein, alpha 1, 43kDa, gap junction protein, alpha 1, 43kDa (connexin 43), GJAL, HSS, ODD, ODDD, ODOD, SDTY3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQAS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title