missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30517292

Coronin-1a Antibody [PerCP], Novus Biologicals Biologicals™

Product Code. 30517292 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30517292 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30517292 Supplier Novus Biologicals Supplier No. NBP338604PCP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Coronin-1a Polyclonal antibody specifically detects Coronin-1a in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Coronin-1a
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate PerCP
Formulation PBS
Gene Alias clipin-A, CLIPINA, CORO1, coronin, actin binding protein, 1A, coronin, actin-binding protein, 1A, coronin-1, coronin-1A, Coronin-like protein A, Coronin-like protein p57, FLJ41407, HCORO1, MGC117380, p57, TACOCLABP, Tryptophan aspartate-containing coat protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 362-461 of human Coronin-1a (NP_001180262.1).,, Sequence:, DLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Immunology, Innate Immunity, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 11151
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.