missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CRM1 Polyclonal antibody specifically detects CRM1 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | CRM1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 532 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | Chromosome region maintenance 1 protein homolog, DKFZp686B1823, emb, exp1, exportin 1 (CRM1 homolog, yeast), exportin 1 (CRM1, yeast, homolog), exportin-1, Exportin-1 (required for chromosome region maintenance), yeast, homolog |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 964-1064 of human CRM1 (NP_003391.1).,, Sequence:, PGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHE |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?