missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CROT Polyclonal antibody specifically detects CROT in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot
Specifications
Specifications
| Antigen | CROT |
| Applications | ELISA, Immunoprecipitation, Western Blot |
| Classification | Polyclonal |
| Conjugate | Biotin |
| Formulation | PBS |
| Gene Alias | carnitine O-octanoyltransferase, COTperoxisomal carnitine O-octanoyltransferase, EC 2.3.1, EC 2.3.1.137, peroxisomal carnitine acyltransferase, peroxisomal carnitine octanoyltransferase |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CROT (NP_001230674.1).,, Sequence:, MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?